Merck Anti-BIN1 antibody produced in rabbit
다른 상품 둘러보기
Anti-BIN1 antibody produced in rabbit
Ab1, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunohistochemistry: 1:50-1:200
면역원 서열
VTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTRLQKDLRTYLASVKAMHEASKKLNECLQEVYEPDWPGRDEANKIAENNDLLWMDYHQKLVDQALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHH
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... BIN1(274)
Bridging integrator-1 (BIN1), also called amphiphysin II, is a nucleocytoplasmic protein which is ubiquitously expressed. It is a ligand to the transcription factor Myc and also interacts with SRC SH3, which is a tyrosine kinase ligand. Amphiphysin II is a member of the amphiphysin family, along with amphiphysin I. Depending upon the cell type, human BIN1 gene is alternatively spliced. In humans, BIN1 gene is located on chromosome 2q14 and has 20 exons. Gene splicing leads to various isoforms, of which isoform 8 is found in skeletal muscles, 1 to 7 in brain and 9 and 10 are expressed ubiquitously. It is also called SH3P9, and has an N-BAR (Bin-amphiphysin/Rvs) domain, a phosphoinositide (PI) binding motif, clathrin and AP2 (CLAP) binding domain, Myc-binding domain (MBD) as well as SRC homology 3 domain.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|