Merck Anti-ASGR2 antibody produced in rabbit
다른 상품 둘러보기
Anti-ASGR2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
orthogonal RNAseq
recombinant expression
independent
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:5000-1:10000
면역원 서열
QSAQLQAELRSLKEAFSNFSSSTLTEVQAISTHGGSVGDKITSLGAKLEKQQQDLKADHDALLFHLKHFPVDLRFVACQMELLHSNGSQRTCC
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... ASGR2(433)
ASGR2 (asialoglycoprotein receptor 2) is one of the two subunits of the hetero-oligomeric ASGP-R, which is expressed specifically on hepatocytes. It is also called H2 and shares high homology with the other subunit called H1. ASGP-R is present on the plasma membrane of hepatocytes, towards the sinusoidal side, and undergoes endocytic recycling. This receptor is a type II membrane protein, and thus, ASGR2 has its N-terminal towards the cytoplasm, one transmembrane region, a stalk region and a Ca2+-dependent CRD (carbohydrate recognition domain). The molecular weight of this subunit is ~ 50kDa.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|